PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4DL_FD6DBA41D.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 220aa    MW: 23887.8 Da    PI: 8.2481
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4DL_FD6DBA41D.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.96.2e-151461148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           rg+W+ eEd +l d ++++G g+W+ I+r  g  R +k+c++rw++yl
  Traes_4DL_FD6DBA41D.2 14 RGPWSREEDAKLTDHIAKHGLGRWSDIPRLAGIERGGKSCRLRWLNYL 61
                           89******************************6699**********97 PP

2Myb_DNA-binding38.13.7e-1271109545
                            -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
        Myb_DNA-binding   5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                            ++eE++l+++++   G+  W++Ia++++ gRt++ +k++w+
  Traes_4DL_FD6DBA41D.2  71 SQEEEDLIIQLHSIIGNS-WTLIAACLP-GRTDNGVKNFWN 109
                            89**************99.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.989965IPR017930Myb domain
SuperFamilySSF466897.49E-2912108IPR009057Homeodomain-like
SMARTSM007171.1E-121363IPR001005SANT/Myb domain
PfamPF002491.1E-131461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.6E-221568IPR009057Homeodomain-like
CDDcd001673.13E-111661No hitNo description
PROSITE profilePS5129415.53366116IPR017930Myb domain
SMARTSM007172.0E-866114IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.1E-2069116IPR009057Homeodomain-like
PfamPF002491.0E-1071109IPR001005SANT/Myb domain
CDDcd001676.81E-971109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 220 aa     Download sequence    Send to blast
MSKAPRGPRK AVRRGPWSRE EDAKLTDHIA KHGLGRWSDI PRLAGIERGG KSCRLRWLNY  60
LRPDLKRAAL SQEEEDLIIQ LHSIIGNSWT LIAACLPGRT DNGVKNFWNA SIKHKLRRRG  120
IDPDTHEPMV DEGTRNGDAQ HILPSHLAAG SNTCSHGALP LPDSITSYVD TDPLELQHGV  180
VLVQPVVSSS SKVGSDPSST GSDTGEQCPN GADRAASCSI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-301411627128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004958441.15e-63PREDICTED: myb-related protein Zm1-like
SwissprotQ8LPH64e-55MYB86_ARATH; Transcription factor MYB86
TrEMBLW5ENF61e-161W5ENF6_WHEAT; Uncharacterized protein
STRINGSi029872m2e-61(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30923385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21440.12e-56MYB-like 102
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]